Protein Info for RR42_RS27070 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details PF02308: MgtC" amino acids 10 to 129 (120 residues), 127.5 bits, see alignment E=3.6e-41 PF21770: MgtC_SapB_C" amino acids 148 to 226 (79 residues), 80.2 bits, see alignment E=1.3e-26

Best Hits

Swiss-Prot: 47% identical to MGTC_SALCH: Protein MgtC (mgtC) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 60% identity to eta:ETA_33800)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBD0 at UniProt or InterPro

Protein Sequence (234 amino acids)

>RR42_RS27070 membrane protein (Cupriavidus basilensis FW507-4G11)
MVWHEFALRLLEALALGACIGTERQLRQRMAGLRTNALVAAGAALFVSVSAFTFDPQGHA
RIAAQVVSGIGFLGAGVIMRDGLNVRGLNTAATLWCSAAVGVLAGLGHALEAAIGTACIL
CANFGLRMLGQRINRNGTATAPEVEMVYRITTVCTAQEEIRVRGLLLHALTEMPALLLQS
LHSEDTAAGGHIEVRADVLAAPGNEGKLEQIVSRISMEKSVSLVRWAIPAGALE