Protein Info for RR42_RS26960 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 184 to 208 (25 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details amino acids 387 to 412 (26 residues), see Phobius details amino acids 421 to 447 (27 residues), see Phobius details amino acids 462 to 481 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 35 to 204 (170 residues), 25.6 bits, see alignment E=5.7e-10 PF07690: MFS_1" amino acids 35 to 438 (404 residues), 161.8 bits, see alignment E=2.3e-51

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YLG8 at UniProt or InterPro

Protein Sequence (490 amino acids)

>RR42_RS26960 MFS transporter (Cupriavidus basilensis FW507-4G11)
MTFSSLNRAESAPVPHHAAASSPTAMDRLALLVMLSGTFMVVTDFFIVNVALPAIQRELH
ASAGALQFVVAGYGLANATGLITGGRLGDMLGRRRMFMLGLLLFALASAACGLAPSAPAL
VAARVAQGLAGALLQPQVLAMLSLTYTGPARARAFAAYGLTLGLAALLGQLVGGALIRAD
PGGLGWRACFLINVPVAIIALLLAPRVLRASPPTSGSKPDVPGMALLAAALGALVWPLVE
GRQQGWPPTTLLALAMAPVLLAMFAWHQRRLHARGGQPLVSPALFAAPGFARGLAVTVAF
YAGNASFYFVLALYLQDGLGLSPLQGGGAFTMLALGFFATSLAAPRIAARLGRSSIAYGA
MLLAAGHWLQLANTLLPWQAQGPGLMTVMLILLVVQGAGIGMVMAPLASAVLAGTAQHHA
GVAAGVLATVQQVGNSVGVALVGNLFYARLESAGTAHGYDSAFAWCLGCLLGLALLVTHL
CHGRRLAAAL