Protein Info for RR42_RS26825 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 25 to 40 (16 residues), see Phobius details amino acids 60 to 85 (26 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 370 to 393 (24 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 391 (361 residues), 158.5 bits, see alignment E=1.1e-50

Best Hits

KEGG orthology group: None (inferred from 90% identity to reh:H16_B2127)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YLD8 at UniProt or InterPro

Protein Sequence (435 amino acids)

>RR42_RS26825 MFS transporter (Cupriavidus basilensis FW507-4G11)
MGDAVEAPRVESALDAAAFAKVTRRIVPFIVLCYFFSYLDRVNVGFAKLQMQQALGLSDV
VYGIGAGIFFWGYMLCQVPSSLLIYRLGMRKSMAAIMIMWGLVSAATMLVSTPAEFYFAR
FMLGVTEAGFFPAAVMYLNKWYPAARQSKIMSILFLAMPLGMVLGGPISGALMSGTHDLH
GLQGWQWMFLIEALPAIVLGLLVLRMLPESPQTAPWLTREEAAAITTTLSTENARKNTSF
VAALKSPVLWMLMGICLLFNIGNYGLVFWLPTIIQSTGMQSPLEIALLTAIPYGVACVVM
NRNAAHAQRVGERRLHAAVPLFVAAAAMWASTLFAHNTVMAMVFLTIGISGLMATLAMFW
GLPGRVLAGTAAAGGIAMINSAASLAGLIGPVLMGGIKQSTGSISLGVLALAAMMLIAAV
LILAIPRALMSDRQV