Protein Info for RR42_RS26800 in Cupriavidus basilensis FW507-4G11

Annotation: RND transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 41 to 367 (327 residues), 172 bits, see alignment E=8.1e-55 PF16576: HlyD_D23" amino acids 61 to 290 (230 residues), 67.6 bits, see alignment E=1.5e-22 PF13533: Biotin_lipoyl_2" amino acids 63 to 103 (41 residues), 31.4 bits, see alignment 1.9e-11 PF13437: HlyD_3" amino acids 186 to 290 (105 residues), 42.6 bits, see alignment E=1.3e-14

Best Hits

KEGG orthology group: K02005, HlyD family secretion protein (inferred from 56% identity to slt:Slit_2080)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YLD5 at UniProt or InterPro

Protein Sequence (391 amino acids)

>RR42_RS26800 RND transporter (Cupriavidus basilensis FW507-4G11)
MTRNRLVRRIAIVVAILVGLVVAGWYATRAKPVAVLTARVEQGRVEATVANTRAGAVSAC
RRAKLAPPAAGRIEVLNIHKGDRVKAGQVLLVLWNEDLVAREQLSQHQLLTATAHAREVC
ELAKVAASDARRSRELVAKGFVSPQAVERTDADADSRRAACESARAQVKEAGARIAASRA
DTARTVLKAPFDGVVAEVNGEIGEYLTPSPPGIPTLPAVDLIDDSCLYVSAPIDEIDAAR
LQVGMPARVTLDAYRGRHFEGRLRRVAPYVLALEKQARTVEVEVQFDSPDLVRHLLVGYS
ADVEIVTDARDQTLRIPTTALASGNRVLVLNPAGRLEARTIGTGIANAEFTEVTAGLRRG
ERVVTSPERIGLQAGIAAVEAEPATAETQAK