Protein Info for RR42_RS26785 in Cupriavidus basilensis FW507-4G11

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 271 to 300 (30 residues), see Phobius details amino acids 320 to 353 (34 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 21 to 242 (222 residues), 151.2 bits, see alignment E=4.9e-48 PF02687: FtsX" amino acids 278 to 391 (114 residues), 75 bits, see alignment E=5.3e-25

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 63% identity to gca:Galf_2067)

Predicted SEED Role

"putative ABC transporter protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YQF1 at UniProt or InterPro

Protein Sequence (399 amino acids)

>RR42_RS26785 peptide ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MRHADFIHFTLASLAAHRLRSSLTALGIAVGIAAVILLTSIGEGLHRFVIEEFTQFGTNL
IGVTPGRTQTHGASLGSINTVRPLTIEDAIALRHAPHVRVTNPLVQGNAEVDYLGKSRRV
TLYGVGPRFTEALSMRVAAGQFLPDDDPRAARTLAVLGARVARELFGGDNPLGARIRVGG
ERYRVVGVMEAKGQMLGFDLDDTVYIPAGRALDLFNRESLVEIEVTYDPTAALPDVEDGI
KRLLSARHGAEDFTVTPQQKMLEVFGTVLDAITFAVAAIGAISLIVGGVGILTILTIAVA
ERTSEIGLLRAIGATEAQVMLLFLGEAALLAAIGGMIGLLLGWGIALVLAAVLPALPVHT
PWSYAMLAELVAVVIGLAAGVLPARRAARLAPQEALRSE