Protein Info for RR42_RS26410 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 27 to 176 (150 residues), 68.5 bits, see alignment E=1.9e-22 PF13579: Glyco_trans_4_4" amino acids 27 to 170 (144 residues), 35 bits, see alignment E=4.4e-12 PF00534: Glycos_transf_1" amino acids 192 to 353 (162 residues), 107.3 bits, see alignment E=1.6e-34 PF13692: Glyco_trans_1_4" amino acids 202 to 340 (139 residues), 113.2 bits, see alignment E=3e-36 PF13524: Glyco_trans_1_2" amino acids 225 to 355 (131 residues), 25.9 bits, see alignment E=2.2e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YQ67 at UniProt or InterPro

Protein Sequence (401 amino acids)

>RR42_RS26410 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MMHADRVAALSAGQLRVLVLNSRLDGGGIDSHTLSLCRALRMQDCLVSLAAPARARWIDA
AQAMPGIQVLALDAGRAVWPLALSRYIREQRIDVIHAHHGRDYWVAIAAWMLSGRTASVV
VTRHLMTQLKERTRRYLAAFSNVIAVSDAVQESLRRVDPERALRLRRIYCGIDTERFRRI
AMRGDRVREALGLPQHAWVYAMIGGAQRPDGKGQFYFVKAAAKVLARHPHAHFLCVGEGD
LIPQLRRQAQALGLAGHIHFLPFEHDVASLMQAIDVLVHPAVGSEALGLVILEALSCSKP
VIATALDGIPETFLDGAHGVLVPPRDTHALAQAMCQLAADPGRAARMGRRGRGWVEVNFS
LASLGRETVQLYRDCVTAARHRDRARIAQSGQAARATSERT