Protein Info for RR42_RS26230 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 18 to 42 (25 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 155 to 181 (27 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 243 to 267 (25 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 334 to 360 (27 residues), see Phobius details amino acids 373 to 397 (25 residues), see Phobius details amino acids 403 to 422 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 20 to 219 (200 residues), 79.1 bits, see alignment E=3.4e-26 amino acids 240 to 423 (184 residues), 33.9 bits, see alignment E=1.8e-12 PF07690: MFS_1" amino acids 34 to 365 (332 residues), 94.8 bits, see alignment E=5.2e-31 amino acids 250 to 420 (171 residues), 39.5 bits, see alignment E=3.4e-14

Best Hits

KEGG orthology group: None (inferred from 81% identity to azc:AZC_1948)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YB06 at UniProt or InterPro

Protein Sequence (424 amino acids)

>RR42_RS26230 MFS transporter (Cupriavidus basilensis FW507-4G11)
MHQPEAGRAPRNMKKIAAASVIGTTVEWYDLFIFATASALVFNKVFFPAFDPLTGTLLAF
GTFASAYLARILGAALFGHFGDKVGRKSMLLISLIMMGSATFAIGLLPDYRSIGIWAPIL
LLTLRVIQGLALGGEWGGAVLMAVEHAPADKRGLYGSWVQIGVPAGTLIANLAFLLCNAV
LPNEALLSWGWRIPFLASVLLVGVGMYIRLNTSETPSFSKVKATAAQVKIPLAEVLTKSW
KQVLLGGIATMSTGTAFNLIVAFGLTYGTQTLGFSRNQMLTIALLSCALCIVLLPLFGLL
SDKVGRKPVIIGGIIAEALLAFPLFWLLDTKVFSFALLGYLLMMSAFAANYGPIATFLAE
LFGTKVRYSGLSISYMLSGLLGSAATPIITTALLSATGRGSSVAWYMIGSALISAVALLL
LAET