Protein Info for RR42_RS26115 in Cupriavidus basilensis FW507-4G11

Annotation: dihydrolipoamide dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 6 to 76 (71 residues), 62.6 bits, E=1e-20
• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 125 to 578 (454 residues), 460.6 bits, E=2.8e-142
• PF01134: GIDA
  • amino acids 126 to 186 (61 residues), 24.7 bits, E=4.8e-09
• PF07992: Pyr_redox_2
  • amino acids 126 to 445 (320 residues), 190 bits, E=2.7e-59
• PF12831: FAD_oxidored
  • amino acids 126 to 162 (37 residues), 31.8 bits, 4.1e-11
• PF00070: Pyr_redox
  • amino acids 294 to 363 (70 residues), 43.8 bits, E=1.2e-14
• PF02852: Pyr_redox_dim
  • amino acids 464 to 572 (109 residues), 114.3 bits, E=1.3e-36

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 86% identity to bja:blr3722)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

See A0A0C4YQ29 at UniProt or InterPro

Protein Sequence (589 amino acids)

>RR42_RS26115 dihydrolipoamide dehydrogenase (Cupriavidus basilensis FW507-4G11)
MTQRVEVKVPDIGDFKDVTVIEVMVKPGEIIAVDTSLIAVESDKASMEIPSTHAGVVKEI
TVKVNDKVSEGSVILVVEAAAAAATVAAPAAPAPAAPSAPPGPAPAAAPVPNAASYTGKA
DQECEMLVLGAGPGGYSAAFRSADLGMKTVLVERYDTLGGVCLNVGCIPSKALLHTASVM
DEVATLPDHGIRYGAPEIDLDKLRGFKDSVIKKLTGGLAGMAKARKVEVVTGVGSFLDPY
HLEVVAADGGKRVIKFAKAIIAAGSQAVKLPFMPDDERVVDSTGALLLKSIPKRMLVVGG
GIIGLEMATVYSTLGTRIDVVEMLDGLMQGADRDLVKVWEKKNTHRFDHVMLKTRTIGAK
ATPAGIEVSFEGEKAPAPQVYDLVLVAVGRSPNGRAIGAEKAGVAVTERGFIDVDRQMRT
NVAHIHAIGDIVGQPMLAHKAVHEAHVAAEAAHGEAAYFDARQIPSVAYTDPEVAWAGKT
EEQCKAEGIKIGKAVFPWAASGRAIANGRDEGFTKLLFDEATHRVIGGGIVGTHAGDLIS
EVCLAIEMGCEPADIGKTIHPHPTLGESIGMAAEVFEGHCTDLPPVKKK