Protein Info for RR42_RS25990 in Cupriavidus basilensis FW507-4G11

Annotation: cytochrome o ubiquinol oxidase subunit III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02842: cytochrome o ubiquinol oxidase, subunit III
  • amino acids 21 to 198 (178 residues), 274.2 bits, E=3.3e-86
• PF00510: COX3
  • amino acids 22 to 196 (175 residues), 51.4 bits, E=7.4e-18

Best Hits

Swiss-Prot: 60% identical to CYOC_PSEAE: Cytochrome bo(3) ubiquinol oxidase subunit 3 (cyoC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 76% identity to rso:RSc1860)

MetaCyc: 59% identical to cytochrome bo3 subunit 3 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (2/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (2/2 steps found)
• proline to cytochrome bo oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

See A0A0C4YAX5 at UniProt or InterPro

Protein Sequence (200 amino acids)

>RR42_RS25990 cytochrome o ubiquinol oxidase subunit III (Cupriavidus basilensis FW507-4G11)
MSYTVIHNTHEHVAHDDGSKTTLGFWIYLMSDCLIFAVLFATFGVLAGNTAGGPSGRELF
ELPFVLGETMLLLISSFTFGVAMLNMQPGRERQVIQWLGITFLLGAAFIAMELYEFAELL
HAGAGPGVSAFLSAYFSLVGTHGLHVSCGLLWILVMMHQVKSFGLDGVTRRRLACLSLFW
HFLDLIWICVFTFVYLREFV