Protein Info for RR42_RS25835 in Cupriavidus basilensis FW507-4G11

Annotation: cytochrome D ubiquinol oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 185 to 209 (25 residues), see Phobius details amino acids 221 to 238 (18 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 10 to 432 (423 residues), 536.7 bits, see alignment E=1.7e-165

Best Hits

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 87% identity to rme:Rmet_5232)

MetaCyc: 47% identical to cyanide insensitive ubiquinol oxidase subunit I (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAT6 at UniProt or InterPro

Protein Sequence (459 amino acids)

>RR42_RS25835 cytochrome D ubiquinol oxidase subunit I (Cupriavidus basilensis FW507-4G11)
MFSSLDPVVLARVQFAANITFHILFPTISISLGWVLLFFKLRFNKTGDERWMAAYRFWVK
IFALTFALGVVSGITMSFQFGTNWPGYMETVGNVAGPLLAYEVLTAFFLEATLLGIMLFG
MRRVSNRTHTIATLLVAGGTTLSAFWILALNSWMQTPAGFEIIDGRVHVTSWLAVIFNPS
FPYRFVHMLLASGLTVAFLLAGISAYRWLRGDRAPEVLSSLRTGVTIAAVLIPLQIVAGD
LHGLNTLHHQPAKIAAMEGIWKTEKGAPAVLFGVPNASTQSNDFEIAIPKLASLYLTHHM
DGEIKGIDAFGDKHPPVAPLFFAFRIMVGVGLLMLAASWAAAWQLRRGGQPAPWMARVLI
AMTFSGWVALVAGWYVTEIGRQPYLVYGVLTTAQAASKVPAAMIASTLAMYLALYLALIA
AYVSVVFHLARKAGTDPKVDSPRTAPPQAVLPGEPRSAE