Protein Info for RR42_RS25605 in Cupriavidus basilensis FW507-4G11

Annotation: N-ethylmaleimide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00724: Oxidored_FMN" amino acids 6 to 335 (330 residues), 278.9 bits, see alignment E=3.3e-87

Best Hits

KEGG orthology group: K10680, N-ethylmaleimide reductase [EC: 1.-.-.-] (inferred from 87% identity to pfo:Pfl01_2479)

MetaCyc: 55% identical to nitroglycerin reductase (Agrobacterium tumefaciens)
1.7.1.-; 1.7.1.-

Predicted SEED Role

"2,4-dienoyl-CoA reductase [NADPH] (EC 1.3.1.34)" (EC 1.3.1.34)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.3.1.34

Use Curated BLAST to search for 1.-.-.- or 1.3.1.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAP8 at UniProt or InterPro

Protein Sequence (364 amino acids)

>RR42_RS25605 N-ethylmaleimide reductase (Cupriavidus basilensis FW507-4G11)
MTDKTLFKPYTLGSLTLSNRVVLAPLTRNRAGAGFVPGELAATYYSQRASAGLLISEATQ
ISQQGQGYQDTPGIYTQAQIDGWRQVTDAVHAKGGRIFLQLWHVGRVSHVDLQENGAAPV
APSAIQAGTKTFVNNGFTDVSAPRALELDELPGIVNDFRQAAANAVAAGFDGVEIHGANG
YLLDQFLRDAANVRTDAYGGSVENRARLVLEVARAVVNEIGAERTGIRISPVSPANGVSS
SDPQAQFDYLVEQLDALGLVYLHVVEGATGGPRDVAPFDYDALRKRFKNTYIANNGYDLA
LAAARLNEGKADLFAFGRPFIANPDLVERLKTGAPLADFNPATLYGGGAEGYTDHPTLAE
ASAQ