Protein Info for RR42_RS25595 in Cupriavidus basilensis FW507-4G11

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF00561: Abhydrolase_1" amino acids 41 to 273 (233 residues), 77.2 bits, see alignment E=3.3e-25 PF12697: Abhydrolase_6" amino acids 58 to 278 (221 residues), 67.2 bits, see alignment E=7.1e-22 PF12146: Hydrolase_4" amino acids 68 to 268 (201 residues), 57.6 bits, see alignment E=2.5e-19 PF08386: Abhydrolase_4" amino acids 226 to 276 (51 residues), 26.7 bits, see alignment 9.8e-10

Best Hits

KEGG orthology group: None (inferred from 84% identity to rsl:RPSI07_mp0902)

Predicted SEED Role

"2-hydroxymuconic semialdehyde hydrolase (EC 3.7.1.9)" in subsystem Central meta-cleavage pathway of aromatic compound degradation (EC 3.7.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.9

Use Curated BLAST to search for 3.7.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YIW4 at UniProt or InterPro

Protein Sequence (287 amino acids)

>RR42_RS25595 alpha/beta hydrolase (Cupriavidus basilensis FW507-4G11)
MTHSDKHVRSGTTYANAANLLIDVGGTAFAYRDLGPRSGVPLILLNHWGAVLDNFDPRIV
DGLAGRHRVIATDYRGIGASGGTAPVTIDEMARDAIALIHALGFETVDLLGFSLGGFVAQ
DMVLKAPGLVRKLLLTGTGPAGGQGIDKVGAVSWPLIIKGLLTRRDPKYYLFFTSTANGR
QAAKAFLDRLKERKRNRDKDPTPVAFLRQLKAIKAWGRQAPQDLGNIRIPVLIANGDNDI
MVPTVNSTDMARRIPDAQLVIYEDAGHGGIFQNQADFVSKALSFLNE