Protein Info for RR42_RS25295 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF00132: Hexapep" amino acids 88 to 122 (35 residues), 28.1 bits, see alignment 6.1e-11

Best Hits

Swiss-Prot: 49% identical to Y3753_PSEAE: Uncharacterized protein PA3753 (PA3753) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 75% identity to rpi:Rpic_2058)

MetaCyc: 40% identical to putative transferase CaiE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"carbonic anhydrase, family 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>RR42_RS25295 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MSLYQLGEHSPFVSDSAFVATEATVIGRAELAEHVTIWPGAVIRADNEPIKVGQGSNIQE
GAVLHTDPGIPLTIGANVSVGHQAMLHGCTVGSGSLIGIQAVILNKAVIGEDSLVAAGAL
VTEGKRFPARSLILGSPAKAVRELSDSEVANLHANAADYVKRGATYKTSLKKMV