Protein Info for RR42_RS25230 in Cupriavidus basilensis FW507-4G11

Annotation: NAD synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details PF02233: PNTB" amino acids 10 to 486 (477 residues), 629.1 bits, see alignment E=2.6e-193

Best Hits

Swiss-Prot: 62% identical to PNTB_RHORT: NAD(P) transhydrogenase subunit beta (pntB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00325, NAD(P) transhydrogenase subunit beta [EC: 1.6.1.2] (inferred from 93% identity to reu:Reut_C6058)

Predicted SEED Role

"NAD(P) transhydrogenase subunit beta (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YIN0 at UniProt or InterPro

Protein Sequence (489 amino acids)

>RR42_RS25230 NAD synthetase (Cupriavidus basilensis FW507-4G11)
MDVVSMNLVTLLYLLASICFIQALKGLSHPASARKGNAFGMLGMAVAAITTVALIVKLKN
EFLTAGTAQSSVASGLALIFGALVVGGGIGAYVAKKVEMTKMPELVAAMHSLIGLAAVFI
AVAAVAEPSAFGIAPAGSHAIPLGNRVELFIGCFVGAITFSGSVIAFGKLAGRYKFRLFQ
GAPVVFAGQHMLNLALAVAMVGFGVAFFLTQDWQPFLLMLAIAFVLGVLIIIPIGGADMP
VVVSMLNSYSGWAAAGIGFSLNNPMLIIAGSLVGSSGAILSYIMCKAMNRSFFNVILGGF
GGAATAAVSGSAEQRNVKSGSADDASFLMSNAETVVIVPGYGLAVARAQHALKELTEKLT
EQGVTVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDINSEFGQADVVLVLGANDVV
NPAAKTDPNSPIAGMPILEAYKAKTIIVNKRSMAAGYAGLDNELFYMDKTMMVFGDAKKV
VEDMVKAVG