Protein Info for RR42_RS25060 in Cupriavidus basilensis FW507-4G11

Annotation: nitroreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF00881: Nitroreductase" amino acids 22 to 209 (188 residues), 98.6 bits, see alignment E=4.8e-32

Best Hits

Swiss-Prot: 37% identical to NFNB_MYCS2: Nitroreductase NfnB (nfnB) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: None (inferred from 73% identity to reh:H16_B0366)

Predicted SEED Role

"nitroreductase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAE2 at UniProt or InterPro

Protein Sequence (233 amino acids)

>RR42_RS25060 nitroreductase (Cupriavidus basilensis FW507-4G11)
MQQHPVSRPSGSDVDTLTRLMSERFTCRAYLDKAVPDAVIRSIVNVAKKSASWCNVQPWH
LVIGSQATTEQFRNALLEHAASSPEVDSDLPFPEEYRGVHARRRQETGYRLYEALGIERH
DRERRASQGFENFRLFGAPHVAIVTMAADLGPYAAVDCGGFIASLLLAAHAHGIATTPQG
ALARHARFVRSHFGIGDDRKMICAISFGYADPDHAANSFRTSRAPDEEIMRLV