Protein Info for RR42_RS24115 in Cupriavidus basilensis FW507-4G11

Annotation: C4-dicarboxylate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 54 to 71 (18 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details PF04290: DctQ" amino acids 23 to 158 (136 residues), 76.8 bits, see alignment E=7.6e-26

Best Hits

KEGG orthology group: None (inferred from 54% identity to pol:Bpro_4737)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YNU1 at UniProt or InterPro

Protein Sequence (172 amino acids)

>RR42_RS24115 C4-dicarboxylate ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MQAAVGRLYDFLMVLACLLLLMIVGSITLDVLLRNLVIPGLPRGFPASNDISEYALYFCT
LLAAPWLLRAGQHIRVDIVLRAVPAKLAWACEWLSDVIALTGCVVVAWMGVVMAFRSYAS
GAIQIKSIVIPEWWVMAPLPVAFALLAVEFAFRMWRLAHSQRGPRSDAVSTA