Protein Info for RR42_RS24110 in Cupriavidus basilensis FW507-4G11

Annotation: C4-dicarboxylate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 16 to 42 (27 residues), see Phobius details amino acids 54 to 78 (25 residues), see Phobius details amino acids 100 to 128 (29 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 174 to 198 (25 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 318 to 341 (24 residues), see Phobius details amino acids 361 to 383 (23 residues), see Phobius details amino acids 409 to 433 (25 residues), see Phobius details PF06808: DctM" amino acids 16 to 428 (413 residues), 241.1 bits, see alignment E=1e-75 TIGR00786: TRAP transporter, DctM subunit" amino acids 22 to 434 (413 residues), 288.7 bits, see alignment E=3.2e-90

Best Hits

KEGG orthology group: None (inferred from 72% identity to pol:Bpro_4738)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YI33 at UniProt or InterPro

Protein Sequence (438 amino acids)

>RR42_RS24110 C4-dicarboxylate ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MSAWILPAWLLLGGSTLLLFVGLPVAFAFLITNLVGACMYLGGEAGLVQLARNSVAAVTS
FSLTPIPLFILMGEILFHTGLAVKVIEGVERLITRVPGRLAVVAVVAGSVFSAISGSTIA
TTAMLGSLMVPVMLQRGYHPTMATGPIMAIGAVDMLIPPSALTVLLGSLANISISGLLIG
GIVPGVLLSIGFIAWIVLRCAMNPSLAPAGEFEHFHGWERYKLFFQYVLPLLSIFGVVVG
AMVAGWSTPTESAALGVVATLVIALAYRALSLQALMKSLRGTIGISGMILLIIMGATTFA
QILTFSGASNGIVESITAIGLGPMAIIAGMMLILIFLGIFVDQVSMMLITIPIFMPIVQK
LGVDTVWFGIMFLVCMQMGLLLPPHGLLLMTMKGVAPPTVSMAHIFRAIVPYIAMSVLLL
AALFFFPSIATWLPGIIK