Protein Info for RR42_RS23920 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02743: type-F conjugative transfer system protein TraW" amino acids 10 to 206 (197 residues), 195.6 bits, see alignment E=4e-62

Best Hits

KEGG orthology group: K12061, conjugal transfer pilus assembly protein TraW (inferred from 51% identity to ajs:Ajs_1531)

Predicted SEED Role

"IncF plasmid conjugative transfer pilus assembly protein TraW" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YH01 at UniProt or InterPro

Protein Sequence (208 amino acids)

>RR42_RS23920 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MGGTMRSLLLVVLTATLHLVPAVAADALGPTYPIVEPDLLQDIRRSLQDKERSGKLALLQ
REAVARSEHAMRNPKPARDVVRTLTPRTFYFDPTVAVGQPITGPGGEILVQAGQRFNPLD
EVALRQQLVFFDARDASQVALAAKVIADSRAPSKPILVNGDYLALQKRWQRQVFYDQSGS
LVRKLGIRQVPAVVRQDGKRLRIEEILP