Protein Info for RR42_RS23685 in Cupriavidus basilensis FW507-4G11

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF12802: MarR_2" amino acids 46 to 107 (62 residues), 48.4 bits, see alignment E=1.3e-16 PF01047: MarR" amino acids 47 to 107 (61 residues), 25.9 bits, see alignment E=1.1e-09

Best Hits

Swiss-Prot: 76% identical to BADR_RHOPA: Transcriptional activatory protein BadR (badR) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: None (inferred from 83% identity to reu:Reut_B3914)

Predicted SEED Role

"Benzoate anaerobic degradation transcriptional regulator BadR, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y9P3 at UniProt or InterPro

Protein Sequence (173 amino acids)

>RR42_RS23685 transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MMVNPDFDDDLAPAARMEMANRLFFRLYQCANMLHKTGSRAVEAEGLTTQQWAVLGALSR
PQAADGMSVGDLARYLMVSRQNLSGLISRMERDGHLSMAPDGRDRRSRLVTMTETGRHVW
LRLAQPKIRDYYERALTDFSTGDITHTLHYLLKLLENMKGLDAEGAAGEDARE