Protein Info for RR42_RS23605 in Cupriavidus basilensis FW507-4G11

Annotation: CDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR02622: CDP-glucose 4,6-dehydratase" amino acids 5 to 351 (347 residues), 483.1 bits, see alignment E=2.7e-149 PF01370: Epimerase" amino acids 10 to 242 (233 residues), 109 bits, see alignment E=7.8e-35 PF16363: GDP_Man_Dehyd" amino acids 11 to 323 (313 residues), 125.3 bits, see alignment E=1.2e-39 PF01073: 3Beta_HSD" amino acids 12 to 195 (184 residues), 29.9 bits, see alignment E=8.6e-11 PF04321: RmlD_sub_bind" amino acids 13 to 169 (157 residues), 29.5 bits, see alignment E=1.2e-10 PF02719: Polysacc_synt_2" amino acids 58 to 233 (176 residues), 55.4 bits, see alignment E=1.7e-18 PF07993: NAD_binding_4" amino acids 77 to 192 (116 residues), 21.6 bits, see alignment E=3.3e-08

Best Hits

KEGG orthology group: K01709, CDP-glucose 4,6-dehydratase [EC: 4.2.1.45] (inferred from 67% identity to cti:RALTA_B2137)

Predicted SEED Role

"Similar to CDP-glucose 4,6-dehydratase (EC 4.2.1.45)" (EC 4.2.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YGW4 at UniProt or InterPro

Protein Sequence (352 amino acids)

>RR42_RS23605 CDP-glucose 4,6-dehydratase (Cupriavidus basilensis FW507-4G11)
MLDGYTGRPVFVTGHTGFKGAWLALWLARLGARVTGYALAPESPAGLFTAADVQSTLQAH
HLADIRDASTLAAAMQAAQPEIVFHLAAQPLVGAGYRDPVANWATNVMGTVNLLEAVRHC
PSVRAVVVITTDKCYDNKEWFWGYRETDPLGGHDPYSASKAAAELVAASYRNAFLAERGV
LVATARAGNVIGGGDWSDNRLVPDAARAAAAGAVLEIRNPQATRPWQHVLEALHGYLLLG
ARLMAAEQALARAFNFGPQAADNLAVGAVLARLAQHWPELRWEHRPDPAGAAPHEARNLH
LDSALARGLLGWEPRWSLDQALAATAHWYRAVHEAPAQARSVTERQIEQFCV