Protein Info for RR42_RS23565 in Cupriavidus basilensis FW507-4G11

Annotation: flagellar motor switch protein G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR00207: flagellar motor switch protein FliG" amino acids 5 to 329 (325 residues), 402.7 bits, see alignment E=7.5e-125 PF14842: FliG_N" amino acids 5 to 100 (96 residues), 105.2 bits, see alignment E=3.9e-34 PF14841: FliG_M" amino acids 115 to 186 (72 residues), 83.9 bits, see alignment E=1.2e-27 PF01706: FliG_C" amino acids 218 to 322 (105 residues), 134.4 bits, see alignment E=2.8e-43

Best Hits

Swiss-Prot: 66% identical to FLIG_ECO57: Flagellar motor switch protein FliG (fliG) from Escherichia coli O157:H7

KEGG orthology group: K02410, flagellar motor switch protein FliG (inferred from 90% identity to cti:RALTA_B2145)

Predicted SEED Role

"Flagellar motor switch protein FliG" in subsystem Bacterial Chemotaxis or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YGV7 at UniProt or InterPro

Protein Sequence (330 amino acids)

>RR42_RS23565 flagellar motor switch protein G (Cupriavidus basilensis FW507-4G11)
MTDEGLQKSAILMMSLGEDAAAEVFKHLGPREVQSLGSAMATLNSVTREQMSAVLAEFRQ
ETEQYLALNVDSSAFIRSVLNKALGEERAVSVIEDILESRDPGAGIDSLNWMDSTSVAEL
IRDEHPQIIATILIHLDRQKSSEIIGMFTERLRQDVILRIATFGGVQPGALQELTDVLTK
LLAGQSLKRSRMGGVRTAAEIINLMSTAHEEAVIEGVRLHDGDLAQKIIDEMFLFENLME
VDDRGIQRVLKEVATESLIVALKGAPVELRDKFIRNMSTRAGEMLREDLEALGPVRVSQV
EAEQKNILQVVRRLAEAGEVVIGGGDDAYV