Protein Info for RR42_RS23370 in Cupriavidus basilensis FW507-4G11

Annotation: flagellar motor switch protein FliN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 TIGR02480: flagellar motor switch protein FliN" amino acids 69 to 143 (75 residues), 109 bits, see alignment E=4.2e-36 PF01052: FliMN_C" amino acids 71 to 141 (71 residues), 88 bits, see alignment E=1.6e-29

Best Hits

KEGG orthology group: K02417, flagellar motor switch protein FliN/FliY (inferred from 84% identity to reh:H16_B0565)

Predicted SEED Role

"Flagellar motor switch protein FliN" in subsystem Bacterial Chemotaxis or Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YGR2 at UniProt or InterPro

Protein Sequence (152 amino acids)

>RR42_RS23370 flagellar motor switch protein FliN (Cupriavidus basilensis FW507-4G11)
MTDGKDDKPADPMDDWASALAEQTSAEDLAAAAAPAQAVAATPATATPAASKVFQPLEKE
TPSGFHNDIEMILDIPVQLTVELGRTKVPIKTLLQLAQGSVVELDGLAGEPMDVLVNGYL
IAQGEVVVVNDKFGIRLTDIITPSERIRKLNR