Protein Info for RR42_RS23265 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 357 (341 residues), 112 bits, see alignment E=1.5e-36

Best Hits

KEGG orthology group: None (inferred from 87% identity to cti:RALTA_A1589)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y9G4 at UniProt or InterPro

Protein Sequence (405 amino acids)

>RR42_RS23265 MFS transporter (Cupriavidus basilensis FW507-4G11)
MSDLRPVLPILLGASVMLSLAMGLRQSLGIFMPPLTRDIGISVSDFTIAIAVQNLAWGLL
QPMAGAWATRVGFRPLMMSGSLLYVLGLALLATAHGIAGVTLGAGVAIGASMACTGSAIA
MAVAARPVPAALRSAVLGIVSGAGSLGALVAAPIGQVVAQSFGWRVGLAAFILLALVMLP
AAWYAGKVDRLPLPSLPGAVQQNAREALGAALRNKAFLVMGAAYFVCGMQLVFLTTHLPS
YLDICGMDPMLSAKALGVIGGFNVLGSLFFGWAGGRANKLVLLGTIYSVRSLALAWYFSS
APTPGSTLVFAAVMGFLWLGVAPLVAGWIAQTFGLRWQAMLGGVAFFSHQIGSFVGAFGG
GLVYDALGSYTLAWQIGVALGLAAGLAQIAFAVATRPRPPQLMAT