Protein Info for RR42_RS22915 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 67 to 87 (21 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 176 to 200 (25 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 75 to 239 (165 residues), 105.6 bits, see alignment E=1.3e-34

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 57% identity to rpb:RPB_3093)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJF7 at UniProt or InterPro

Protein Sequence (279 amino acids)

>RR42_RS22915 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MKLLWKRSENSRLAILTIVVLLLIWEGAVRAFGVREFLLPPPSKIFTEFLAQPGFLLMQS
LDTLQTTLAGFVLAVVLGVGSAIGIVYSRFLDRTLYSLMVALNAVPKVALAPLFVIWLGT
GSAPKIAIAMLIAIFPILIDTVLGLKSIDPEMLNMARANQASRSKVLWKIRFPNALPSIF
AGMKVGVSFALVGTIVGEFVAGETGLGHVILVAQGSFDTPTVFVALALLCALGVILFKAL
EWAEERMLPWHASQRGRPGQSHVPASGTERLTQLVQAKR