Protein Info for RR42_RS22840 in Cupriavidus basilensis FW507-4G11

Annotation: DeoR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 23 to 48 (26 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details PF17152: CHASE8" amino acids 47 to 147 (101 residues), 98.5 bits, see alignment E=3.6e-32 PF00672: HAMP" amino acids 186 to 233 (48 residues), 20.7 bits, see alignment 6.4e-08 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 246 to 404 (159 residues), 138 bits, see alignment E=1.2e-44 PF00990: GGDEF" amino acids 250 to 404 (155 residues), 150.9 bits, see alignment E=4e-48

Best Hits

KEGG orthology group: None (inferred from 70% identity to reu:Reut_A2222)

Predicted SEED Role

"Inner membrane protein YfiN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y985 at UniProt or InterPro

Protein Sequence (412 amino acids)

>RR42_RS22840 DeoR family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MKLPLRPDATRSRPTLYNALRRIHLSVALIAVCTAGISLTALGLAALRVYADHNLHLVAR
SVAYTLEAPVVFRDQAAANEALVAIAATEVAQARVYDKDNRLLAEWRRPAGERFPGLQRL
ASRVMALGPVEQEILHETQAVGTVRLTADTGNLLHFVLSGLLGLLACLLLTAVSAHYMSS
RMLVHIIEPVRNLMRVAHAVRSERAFDQRTPPAHIAELNALGEDFNGLLDELETWQNQLQ
HENRSLAHRASHDSLTGLLNRAAFEDALHRAVRFAGTTKGYAGVLYLDSDAFKEINDNFG
HAAGDEVLSDIARRIRSCVREGDLVARLGGDEFAVLLTSLRKPADIVQVAEHILLRMKDP
VQLSSGTRIGASLSIGLSVFPLHAQTAATLMHTADEAMYRAKRRSGGGWETA