Protein Info for RR42_RS22830 in Cupriavidus basilensis FW507-4G11

Annotation: phosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 PF19327: Ap4A_phos_N" amino acids 3 to 183 (181 residues), 264.4 bits, see alignment E=5.8e-83 PF09830: ATP_transf" amino acids 196 to 305 (110 residues), 64.8 bits, see alignment E=1.2e-21

Best Hits

KEGG orthology group: K00988, ATP adenylyltransferase [EC: 2.7.7.53] (inferred from 63% identity to bpy:Bphyt_4727)

Predicted SEED Role

"Ap4A phosphorylase II"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.53

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YH58 at UniProt or InterPro

Protein Sequence (318 amino acids)

>RR42_RS22830 phosphorylase (Cupriavidus basilensis FW507-4G11)
MPHRSLQPGTLWPAILRQTEHALQCGALRPIETFQEGIDDGGVRFLVRQVSSLARKDRDR
DEGHARQHDNAVPGNQAGADPFLPYDPDLFVADISETHLALLNKFNVLDHHLLIVTRRFE
SQDALLNLADFEALLACMAEFDGLGFYNGGAAAGASQRHKHLQLVPLPLASEGPALPIAP
LLAAARMDGADGTVPGLAFSHAFAPLALSSARGPDLARTALARYRALLEAVGVRTIHVDG
APQPLAPYNLLVTPLGMLLVPRSAESVEGISVNTLGFAGSFFVRNEAQMRTIERLGPMAM
LRQAAGPPLSSLASTGRK