Protein Info for RR42_RS22800 in Cupriavidus basilensis FW507-4G11

Annotation: DSBA oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 227 to 244 (18 residues), see Phobius details amino acids 264 to 288 (25 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details amino acids 393 to 415 (23 residues), see Phobius details amino acids 478 to 499 (22 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 404 (388 residues), 174.2 bits, see alignment E=3.7e-55 PF00083: Sugar_tr" amino acids 41 to 179 (139 residues), 27.2 bits, see alignment E=1.9e-10

Best Hits

KEGG orthology group: None (inferred from 69% identity to pfl:PFL_3601)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJE0 at UniProt or InterPro

Protein Sequence (518 amino acids)

>RR42_RS22800 DSBA oxidoreductase (Cupriavidus basilensis FW507-4G11)
MSGMNSRAALLTASGACALIVLDTNIVAVTLPRIASDLHATFSDIEWVVSAYMLTFAGGL
LPAGSLADKFGRKRMLLTGLAVFMLASLGCGLAGSSLALNLARAVKGVGAAMLLTSALAT
IAHAFHDERERARAWAFWGACMGVAMLVAPGLGGVISQALGWRWVFLLNLPVGILLGAMV
LRHIAESRDTGAARIDLWGGLCFCGSLFLMIWALIEANRIGWGDMHTQMRLAGGAVLFAL
FIGVERIQRRPMVDLALFRNPRLIGALLGMAAYAACAQVMMTLIPLYLQTGLGFSAIASG
AAMLPFALTMLIFPRIGVQLSGRLDAPSMLVFGLVLVGLGNLLSAWAAVTMSYLPFALAI
AVTGSGAGLLNGDTQKNIMACIPRERSGMASGISTTTRFSAIVLSFGLLGGLLAYHTEAA
FDTALHAHAQSAGVMPGMAAHIIPRVVAGDLHGAMADVPASLRSVLEPLARTAFADGFAW
ILCVAAGVALLSAVLVRLLMKDEAAAHQAVRVEVPARR