Protein Info for RR42_RS22450 in Cupriavidus basilensis FW507-4G11

Annotation: phosphonopyruvate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 82% identity to rme:Rmet_1809)

MetaCyc: 44% identical to phosphonopyruvate decarboxylase (Kitasatospora phosalacinea)
Phosphonopyruvate decarboxylase. [EC: 4.1.1.82]

Predicted SEED Role

"Phosphonopyruvate decarboxylase (EC 4.1.1.82)" (EC 4.1.1.82)

MetaCyc Pathways

2-aminoethylphosphonate biosynthesis (3/3 steps found)
methylphosphonate biosynthesis (2/4 steps found)
fosfomycin biosynthesis (2/7 steps found)
rhizocticin A and B biosynthesis (2/12 steps found)
dehydrophos biosynthesis (2/13 steps found)
phosalacine biosynthesis (4/25 steps found)
phosphinothricin tripeptide biosynthesis (4/25 steps found)

KEGG Metabolic Maps

Aminophosphonate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.82

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YN00 at UniProt or InterPro

Protein Sequence (393 amino acids)

>RR42_RS22450 phosphonopyruvate decarboxylase (Cupriavidus basilensis FW507-4G11)
MIEAAQFVEAARARGFDWYAGVPCSYLTPFINYVMQDPSLHYVSAANEGDAVALIAGVTL
GAQGGRRGVTMMQNSGLGNAVSPLTSLTWTFRLPQLLIVTWRGQPGVADEPQHALMGPVT
PTMLDTMEIPWETFPTDPAEVGPALDRAVAHMDATGRPYALVMQKGSVAPYALKQQEQPA
LRPKCTPQSEARGASRDGLPTRRDALQRVIAHTPTDKTVVLASTGFCGRELYALDDRANQ
LYMVGSMGCLTPFALGLALARPDLNVVAVDGDGAALMRMGVFATLGAYGPGNLTHVLLDN
GAHDSTGGQATVSHHVSFAGVASACGYASAAEGDQLDLLDQTLTAAPASAAGPRFVALTI
SAGTPDGLPRPTITPVDVKTRLARHIGADQGGK