Protein Info for RR42_RS22320 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 27 to 44 (18 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details amino acids 414 to 434 (21 residues), see Phobius details PF07690: MFS_1" amino acids 35 to 399 (365 residues), 164.4 bits, see alignment E=1.8e-52

Best Hits

Swiss-Prot: 44% identical to NICT_PSEPK: Putative metabolite transport protein NicT (nicT) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 75% identity to vpe:Varpa_4232)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YG37 at UniProt or InterPro

Protein Sequence (435 amino acids)

>RR42_RS22320 MFS transporter (Cupriavidus basilensis FW507-4G11)
MNTAALTKPAGAAAADPASDAELFRKITWRLLPLLCVCYVFNYLDRTNVGYAQLQMREDL
GFGDAVFGLGASIFFLGYALFEVPSNLMLAKIGVRATLLRIMGLWGLASAAMIFVSTPTQ
FYALRFLIGVLEAGFAPGVLYYFTLWYPSRRRAQVTALFFMAYGAAPIVAGPLAGLVMTF
LNGAWSLQGWQWLFLLEGIPSALLGILAFFILSDGPAQARWLSAPERQRVVRLLEEDQAA
NGIRAAHGFGAAMRDRRVWMLGLISFLAILGIYALSFWQPTLLKMMGLSVLQVGFYAVVP
AVTGIAASIVVGRHSDRTGERRWHFAVAALVGALGLSLTTLFMHNPLAAVLCLALSSAGI
SSAFTILWSVPGSILADRGAAAGIAMISTIGSSAGLVAPVMVGAIKAATGGFTVSLYILS
AALVLAALLFVLAFP