Protein Info for RR42_RS22305 in Cupriavidus basilensis FW507-4G11

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 182 to 204 (23 residues), see Phobius details PF00672: HAMP" amino acids 202 to 256 (55 residues), 29.2 bits, see alignment 2e-10 PF00512: HisKA" amino acids 269 to 336 (68 residues), 52.8 bits, see alignment E=6.8e-18 PF02518: HATPase_c" amino acids 386 to 488 (103 residues), 88.4 bits, see alignment E=8.9e-29

Best Hits

KEGG orthology group: None (inferred from 79% identity to bxe:Bxe_B0814)

Predicted SEED Role

"Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)" in subsystem Potassium homeostasis (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YGR8 at UniProt or InterPro

Protein Sequence (497 amino acids)

>RR42_RS22305 histidine kinase (Cupriavidus basilensis FW507-4G11)
MSRRLTLTQRLSLVFSVLLLACCGASAWLQVRSNDMREKEVIQDLSRGLAGHIARNASLM
DANGLKPDALRRLFGQLMVVNPSVEVYLLDSQGRIQGHDAPAGHLQRQQVDLKPVQRLLA
GEPLPILGDDPRSAGGRKVFSAAPLRVGGAEPAGYIYVVLLGEAHDELAARASANSVLRT
TLWSMGLVALLGLLAGLMAFGLITRPLRRLTEAMRRFDADGAPETQPRVPRSPRGNARDE
IVALEAAFAQMADRIAEQWRALTKQDQERRELVANISHDLRTPLTSLHGYLETLSLKADT
LSEAERQRYLAIALAQSVKVGRLAQSLFELARLEHGIVQPALEDFSLVDLVQDVFQKFEL
PAEARHVRLRAGIPQRLPAVTADLGMIERVLTNLLDNAIRHTPAEGAIDVDLALRDGKVA
VTVSDTGPGIPAELRESLFQRPFSAGGAHRGGGLGLLIVQRMLQLHHSQIRLVERAGSGT
VFSFELPVSSVAAGNAR