Protein Info for RR42_RS22070 in Cupriavidus basilensis FW507-4G11

Annotation: type IV secretion protein Rhs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 826 TIGR03361: type VI secretion system Vgr family protein" amino acids 31 to 507 (477 residues), 201.7 bits, see alignment E=1.8e-63 TIGR01646: Rhs element Vgr protein" amino acids 38 to 506 (469 residues), 215.3 bits, see alignment E=1.7e-67 PF05954: Phage_GPD" amino acids 45 to 344 (300 residues), 204.1 bits, see alignment E=4.5e-64 PF13296: T6SS_Vgr" amino acids 482 to 583 (102 residues), 103.9 bits, see alignment E=7.8e-34 PF10106: DUF2345" amino acids 603 to 748 (146 residues), 169.2 bits, see alignment E=8.4e-54

Best Hits

KEGG orthology group: None (inferred from 71% identity to reu:Reut_B5267)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YGM4 at UniProt or InterPro

Protein Sequence (826 amino acids)

>RR42_RS22070 type IV secretion protein Rhs (Cupriavidus basilensis FW507-4G11)
MGAIDEFDAYDAYGARIPRHQAYHLDVPRAASAAELSMVSFEAVERLGELYTVTIRLTHP
LELDRAEYLNRDATFVIDPGDGSEPRRFAGWISAFSRTKRTRDFFAYEIVLRPLAARLEL
VRTTRIYQNKTAPEIIEAILRRHDLRGHQFLLKLRRKYTQHKFRFQYQLSDWEYVQLLMR
QEGLYCYFVPGKFGEMIVFGDDIDHYVYQPELRVPYRETAGLEAGIEAVSDIQVHAKTVP
ESVLVADYNPEQAWEPIKGEANVARKDKTTYGQQYIYGTHLLDTAEAKWEAQLRHEALLA
GQLIYAGESNVLRLHSGGILRMDEPLAEAPNGQVITEVIHTGGRDAAYRNTYKAIPSDRR
FRLPLDEENWPKITGTLSARITSPNQYKHAYLTKAGHYIVRFDFDFEPWPKGMESAAIPL
AKPFAGGLQTGFHFPLIDGTEVAIAFRDGNPNKPYIAHALHNSRQEDLITTQDRWLSRNL
IETQSRSKFQIEDWKDEEHVHISTEHSGKSQLTLGHMVTAKRQKRGEGFELRTSGWGAIR
GGKGVFISADDQPNAGGQQLDMEAAQNLLQQALQLSEALASAANAVQAVAADYNRQKALL
SDTLTALNKAGILVSAPAGIALASGSDLQLTAAQNLIATAGGHADISVLKRFTVAAGERI
SMFAQKLGIKLFAAKGKVEIQAQSDEMRLLSDKNMTISSANGRVVIEAREELLLKCGGSY
LRLSSTGIEDGTRGDRTIKSAAFSRQGPTSLAQHMNSLATTAFNDPYVLRNKVTGEVLKH
QSYEIVREDGTRIKGMTDAMGRTALQNSHDVETVVIRVLDNRGASA