Protein Info for RR42_RS22040 in Cupriavidus basilensis FW507-4G11

Annotation: Hcp family T6SS protein CtsH1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 TIGR03344: type VI secretion system effector, Hcp1 family" amino acids 1 to 160 (160 residues), 175.3 bits, see alignment E=5e-56 PF05638: T6SS_HCP" amino acids 6 to 146 (141 residues), 131 bits, see alignment E=1.7e-42

Best Hits

Swiss-Prot: 40% identical to MAJE_PSEAE: Major exported protein (hcpA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11903, type VI secretion system secreted protein Hcp (inferred from 96% identity to reu:Reut_B5261)

Predicted SEED Role

"Uncharacterized protein ImpD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJ08 at UniProt or InterPro

Protein Sequence (161 amino acids)

>RR42_RS22040 Hcp family T6SS protein CtsH1 (Cupriavidus basilensis FW507-4G11)
MAIPAYMWIKDDGGADIKGSVTVNGREGSVEVVAFDHAVSIPTDSNTGKLTGTRVHKPVV
FTKETDASTPYLYKAVTSGQTLKSVEIKWYKIDDAGKEKEYFNTKLENVKVVGVTPKMLD
IKNPAFEKHNHLEDIELRYEKITWSYKDGNIIHADSWNERS