Protein Info for RR42_RS21780 in Cupriavidus basilensis FW507-4G11

Annotation: bleomycin resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 31 to 42 (12 residues), see Phobius details PF00903: Glyoxalase" amino acids 11 to 143 (133 residues), 60.1 bits, see alignment E=4.2e-20 PF13669: Glyoxalase_4" amino acids 11 to 132 (122 residues), 38.2 bits, see alignment E=2.4e-13

Best Hits

KEGG orthology group: None (inferred from 64% identity to put:PT7_2791)

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.5

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y8P3 at UniProt or InterPro

Protein Sequence (161 amino acids)

>RR42_RS21780 bleomycin resistance protein (Cupriavidus basilensis FW507-4G11)
MTLNMIVPLEVGIAVRDLPRMRRFYEQVLGFAFVSEVAVPAASAMQAAMHAGGYTAVRLQ
TNHGERIKLLAPVQAPAPAAAPEYILDKANSTYLTFIVDDIQATVDKLLAADVEFLTGPQ
RIEVRPGTYLAFCRDPEGNVLEIVQYADIAAYRPDLQLRTA