Protein Info for RR42_RS21740 in Cupriavidus basilensis FW507-4G11

Annotation: acetoin dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00106: adh_short" amino acids 8 to 199 (192 residues), 221.4 bits, see alignment E=1.6e-69 PF01370: Epimerase" amino acids 11 to 174 (164 residues), 21.9 bits, see alignment E=2.2e-08 PF08659: KR" amino acids 11 to 188 (178 residues), 53.2 bits, see alignment E=7e-18 PF13561: adh_short_C2" amino acids 15 to 256 (242 residues), 197.2 bits, see alignment E=6.4e-62

Best Hits

Swiss-Prot: 40% identical to BUDC_CORGT: L-2,3-butanediol dehydrogenase (budC) from Corynebacterium glutamicum

KEGG orthology group: None (inferred from 84% identity to bvi:Bcep1808_1767)

MetaCyc: 40% identical to 2,3-butanediol dehydrogenase subunit (Corynebacterium glutamicum)
(S,S)-butanediol dehydrogenase. [EC: 1.1.1.76]; 1.1.1.- [EC: 1.1.1.76]

Predicted SEED Role

"Short-chain alcohol dehydrogenase associated with acetoin utilization"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.76

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YIW1 at UniProt or InterPro

Protein Sequence (258 amino acids)

>RR42_RS21740 acetoin dehydrogenase (Cupriavidus basilensis FW507-4G11)
MNEPLKRQVAVITGGARGIGRGIALTLAKAGADILIADLLEDAMRETAQDVRALGRRVST
LKVDVTKAEMHRAMVRQALDQLGGLDILVNCAGVISIHPVDALSERDWDFVMDVNAKGTF
LGCQAALEHMKAQHKGRIINVASIAGKEGFPNLAHYSASKFAVVGFTNALAKEVARDGIT
VNAICPGIVRTYMWDRLSDEWKAEGESVEDSWARHQLTLIPQGRAQTPEDMGRMALFFAT
MDNVTGQSVNVDGGFTFH