Protein Info for RR42_RS21720 in Cupriavidus basilensis FW507-4G11

Annotation: acetoin catabolism protein X

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 42 to 60 (19 residues), see Phobius details PF01513: NAD_kinase" amino acids 12 to 166 (155 residues), 71.1 bits, see alignment E=1.2e-23 PF00781: DAGK_cat" amino acids 95 to 149 (55 residues), 24.7 bits, see alignment 1.6e-09

Best Hits

Swiss-Prot: 80% identical to ACOX_CUPNH: Acetoin catabolism protein X (acoX) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 77% identity to cti:RALTA_B0155)

Predicted SEED Role

"Acetoin catabolism protein X" in subsystem Acetoin, butanediol metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YGG0 at UniProt or InterPro

Protein Sequence (374 amino acids)

>RR42_RS21720 acetoin catabolism protein X (Cupriavidus basilensis FW507-4G11)
MGEQALASRPLVGIIANPISARDIRRVIANANTLQLADRVNIVLRLLAALAACGVGRVLM
MPDREGMRVLLSRHLSRRQGPDAALPEVEYLDMPVTARVDDTFLAARMLREAGVAAIIVL
GGDGTHRAVVRECGNVPIAGISTGTNNAYPEMREPTITGLATGLFASGRVPAAHALAANK
RLDITIAGEGEVRHDIALVDAVISHEHFIGARALWKTETLGAVYVSFADPQAIGLSAIGG
LLEPVGRHEPGGLAIELAAPGEGRFALHAPIAPGLLRAVPIAGWERLTDGVAHRVRQRAG
IVALDGERELVFGPQDEVTVTLRERAFLSIDVAACMRYAAAAGLMRSGRAPPPRQPQHSP
PQPLTELSTATTKP