Protein Info for RR42_RS21610 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details amino acids 410 to 430 (21 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 394 (361 residues), 145.2 bits, see alignment E=1.2e-46

Best Hits

Swiss-Prot: 48% identical to TUB4_AGRVI: Putative tartrate transporter (ttuB) from Agrobacterium vitis

KEGG orthology group: None (inferred from 71% identity to del:DelCs14_4301)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFS4 at UniProt or InterPro

Protein Sequence (436 amino acids)

>RR42_RS21610 MFS transporter permease (Cupriavidus basilensis FW507-4G11)
MSYQYPDGAAGVLPAAAEPDIYRKVTWRLIPFFCACYLAAYLDRINVGLAKLQMLDDLHF
SETIYGLGAGLFFVGYILFEVPSNLVLQKVGARLWIARIMVTWGLLSGATMFVTTPTQFY
VLRFLLGAAEAGFLPGVLLYLTYWFPTHKRSKIIALFMMGLPLASMIGSPLSGWIMTAFA
GMHGWAGWQWLFFLEAIPSVLLGVMVFIYLPNGIKDAKWLQADEKRTLQRNLDTDVLVES
NHSLMAAFTDRRVWMLGLIDMCLLMGTYSIGFWMPTIIRDSGVASPLHIGLLTAIPHAAA
VIGMLLNGAHSDKTRERRWHIVLPTLAGAAGLVGSTFVTGSTSATLVMLTVANVGIVATF
PVFWCLPSTFLSGTAAAAGIALACSIANLGGFAATYLLGWLKDTFHSPSAGLILFAGCLV
ASCFLVLAMPAKVVNR