Protein Info for RR42_RS21380 in Cupriavidus basilensis FW507-4G11

Annotation: cupin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF07883: Cupin_2" amino acids 21 to 91 (71 residues), 30.2 bits, see alignment E=1.5e-11

Best Hits

Swiss-Prot: 75% identical to BAUB_PSEAE: Beta-alanine degradation protein BauB (bauB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 85% identity to cti:RALTA_A1424)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y8H9 at UniProt or InterPro

Protein Sequence (105 amino acids)

>RR42_RS21380 cupin (Cupriavidus basilensis FW507-4G11)
MSRPQAVPTVQVDNDRVVVTEWRFAPGAQTGHHRHGYDYVVVPMTTGALRLETPAGEVVS
QLVAGQAYYRGAGVEHNVINAHEGECVFVEIEIKPVAPPPAAGKP