Protein Info for RR42_RS21220 in Cupriavidus basilensis FW507-4G11

Annotation: iron transporter FeoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 623 transmembrane" amino acids 225 to 248 (24 residues), see Phobius details amino acids 283 to 307 (25 residues), see Phobius details amino acids 329 to 352 (24 residues), see Phobius details amino acids 364 to 389 (26 residues), see Phobius details amino acids 402 to 423 (22 residues), see Phobius details amino acids 464 to 482 (19 residues), see Phobius details amino acids 494 to 507 (14 residues), see Phobius details amino acids 519 to 542 (24 residues), see Phobius details amino acids 556 to 577 (22 residues), see Phobius details amino acids 596 to 619 (24 residues), see Phobius details PF02421: FeoB_N" amino acids 16 to 175 (160 residues), 179.8 bits, see alignment E=5.6e-57 PF01926: MMR_HSR1" amino acids 16 to 133 (118 residues), 65.9 bits, see alignment E=7.2e-22 TIGR00437: ferrous iron transport protein B" amino acids 203 to 590 (388 residues), 322 bits, see alignment E=4.5e-100 PF07670: Gate" amino acids 293 to 388 (96 residues), 75.1 bits, see alignment E=1.1e-24 amino acids 463 to 594 (132 residues), 59 bits, see alignment E=1.1e-19 PF07664: FeoB_C" amino acids 405 to 457 (53 residues), 59.2 bits, see alignment 5.2e-20

Best Hits

KEGG orthology group: K04759, ferrous iron transport protein B (inferred from 87% identity to reu:Reut_B5429)

Predicted SEED Role

"Ferrous iron transport protein B" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFN0 at UniProt or InterPro

Protein Sequence (623 amino acids)

>RR42_RS21220 iron transporter FeoB (Cupriavidus basilensis FW507-4G11)
MSVANPTSASQRPALRVALVGNPNCGKTALFNRLTGSRQKVANYAGVTVERKEGHFVSPA
GRQVRVLDLPGAYSLHAASLDEAITRDICLGKRPGEPRPDLLVSVVDATNLRLHLRFVLE
LRRLGLPMVLVLNMSDAAAKRGIRIDRDKLAAALGVPVVQTIAVKRDGAASLLAALDAAL
PQVPDAAPEPASDMDVHQEVKRLLDAAVTMPARTAAMDDRLDRILLHPVFGLVILAVLLF
LMFQAVFSWATPLMDGIEGGVHWFGEIVGSHLPEGMLRSLLVDGLIAGLGAVVVFLPQIL
ILFLFILTLEESGYLPRAAFLLDRLMMGAGLSGRSFIPLLSSFACAIPGIMATRTIQDPR
DRLATILVAPLMTCSARLPVYALLIGAFIPARTVMGMFNLQGLVLFALYVAGIVSALVVA
YVLKYFRRDRTDHPLMMELPSYRIPNVRDVAIGLWERARIFLSRVGKVILTLTVVLWFLA
TFPSPPDGATAPAIDFSFAGMIGRALEHVFAPIGFNWQICIALVPGLAAREVAVGALATV
YALSGSEDAMASQLVPMIAAQWSLATALSLLAWFVFAPQCISTMAVIRRETGSWKVMAAS
TAYLFGLGYVAAFATYHITLMLS