Protein Info for RR42_RS20890 in Cupriavidus basilensis FW507-4G11

Annotation: phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 40 to 62 (23 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 128 to 144 (17 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details PF01569: PAP2" amino acids 73 to 140 (68 residues), 37.7 bits, see alignment E=8.5e-14

Best Hits

KEGG orthology group: None (inferred from 56% identity to rme:Rmet_5834)

Predicted SEED Role

"Membrane-associated phospholipid phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y863 at UniProt or InterPro

Protein Sequence (222 amino acids)

>RR42_RS20890 phosphatase (Cupriavidus basilensis FW507-4G11)
MIPWHLISRFGETSLLLPCAVLIAAWLFHAGAVASARRWLLSFGVTAALVLASKLAFMGW
GIGCAALNFTGFSGHSMMSASVLPVLLYLIVSARHPRLAVGAGGIGLLLALLVGLSRLKL
QAHSGSEVLSGLALGFAVSLSFIFRGRRPARSAPALAGALVIVLMLGVPAVGVAAPTHHW
LEILAARLAGRDKPFQRGQWREWAGQREGSAVLACQPPASPR