Protein Info for RR42_RS20815 in Cupriavidus basilensis FW507-4G11

Annotation: phenylacetic acid degradation protein PaaI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF14539: DUF4442" amino acids 19 to 110 (92 residues), 27.2 bits, see alignment E=5.8e-10 TIGR00369: uncharacterized domain 1" amino acids 24 to 123 (100 residues), 65 bits, see alignment E=3.3e-22 PF13622: 4HBT_3" amino acids 50 to 131 (82 residues), 24.3 bits, see alignment E=4.5e-09 PF03061: 4HBT" amino acids 53 to 125 (73 residues), 58.7 bits, see alignment E=9.1e-20

Best Hits

KEGG orthology group: None (inferred from 87% identity to reu:Reut_A3458)

Predicted SEED Role

"Phenylacetic acid degradation protein PaaD, thioesterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y846 at UniProt or InterPro

Protein Sequence (145 amino acids)

>RR42_RS20815 phenylacetic acid degradation protein PaaI (Cupriavidus basilensis FW507-4G11)
MSTEQERLLLRDTIEAGFRQAAFVADVGIRLVDCGPGWCESELLVTPRHLQHGGIVHAGV
QATIAEHTAGAAASTMLDTGRHVVTAEFKINLLRAARSDRLTCRADVLKSGRAIIVVEAD
VFASVHGEAVLVSRFNATMSVLDLA