Protein Info for RR42_RS20790 in Cupriavidus basilensis FW507-4G11

Annotation: isoprenylcysteine carboxyl methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details PF04191: PEMT" amino acids 111 to 204 (94 residues), 32.7 bits, see alignment E=9e-12 PF04140: ICMT" amino acids 137 to 203 (67 residues), 31.1 bits, see alignment E=2.6e-11

Best Hits

KEGG orthology group: None (inferred from 52% identity to bph:Bphy_5094)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YLW5 at UniProt or InterPro

Protein Sequence (225 amino acids)

>RR42_RS20790 isoprenylcysteine carboxyl methyltransferase (Cupriavidus basilensis FW507-4G11)
MGFKVGMTLAAEGLLFAALLFGAAGTLAWPAAWAYLILFFGGGYWLTQRLARHDPALLAE
RMKMPLQRGQPFWDKILLPCVLAAWIAWMVLMGLDAVRFRWSAMPLWLQCLGAVLLVLSF
LVIDRVFHENTFLAAVVRIQAERGHRVVSSGPYAVVRHPLYATMLVFLPANALMLGSWYG
VAASLVLIGAIVFRTAMEDRELQRGLKGYAAYAARVRYRLVPFVW