Protein Info for RR42_RS20540 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 267 to 284 (18 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 341 (334 residues), 137.4 bits, see alignment E=2.8e-44

Best Hits

KEGG orthology group: None (inferred from 82% identity to cti:RALTA_A3169)

Predicted SEED Role

"Major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFK1 at UniProt or InterPro

Protein Sequence (391 amino acids)

>RR42_RS20540 MFS transporter (Cupriavidus basilensis FW507-4G11)
MDPRLMMLCLGNFVIGTGAMIVTGMLNDIAGDFQLGAGTAGQLISVFALATCVGAPLFAT
LGSRIDRRQLLAGSLLVYAAMHLAAAFAPSFASLMAIRLLSAIGAAIFTPQAAATLPLLV
NAQTRGRAISFVFLGWSVASVVGVPMGTWIASTLGWRFSMGLVGLLALGASVGVWRALPP
RLYVEPAGRAAWGAVLRHTPMVLVVATTMIQSAGMFTLFTYIAPLLRDVHGISGGALSLM
FLAYGACGVSGNVLAASRMDRATPARIVQAAMLTSLAAMLLWPLATLGPVALVLIFMLWG
VGGFATNSAQQARLVALAPERAAVSISLNSSSIYLGQALGAMGGAAIYATAGADSLHWGA
AALMLLALVVSQRARVLGQRWCLRETARQQA