Protein Info for RR42_RS20520 in Cupriavidus basilensis FW507-4G11

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 202 to 225 (24 residues), see Phobius details PF17200: sCache_2" amino acids 47 to 187 (141 residues), 118.3 bits, see alignment E=7.4e-38 PF08269: dCache_2" amino acids 74 to 188 (115 residues), 104.7 bits, see alignment E=1.4e-33 PF17201: Cache_3-Cache_2" amino acids 77 to 190 (114 residues), 38.5 bits, see alignment E=2.2e-13 PF07730: HisKA_3" amino acids 249 to 318 (70 residues), 48.8 bits, see alignment E=2.1e-16 PF02518: HATPase_c" amino acids 359 to 449 (91 residues), 37.4 bits, see alignment E=7.6e-13

Best Hits

KEGG orthology group: K02480, two-component system, NarL family, sensor kinase [EC: 2.7.13.3] (inferred from 87% identity to reu:Reut_A3418)

Predicted SEED Role

"Sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YI13 at UniProt or InterPro

Protein Sequence (468 amino acids)

>RR42_RS20520 histidine kinase (Cupriavidus basilensis FW507-4G11)
MKLRQKILLLAVAPLAVAMFGIALAVRYQATQLASHERALVEAAYLQSKEVELRHYVELA
QSAIAPMVRSGHNDAATRDAAMQALARLDYGPDGYFFLYDLQGRNLMHPRQPELVGQDLW
SLRDPQGALTIQKLIAAARSGGGSVRYMWRKPSSQQLAPKLGYVVAVPEWNWMLGTGIYL
DDVERTLRQLDARAETDIRETMAWIGVIAAISILLVAASGLALNVSEHREADAKLRQLAQ
RVVQSQEEERARLSRELHDGISQLLVSVKLLLETAANRLRMAPDQGQSVAPVLGTALVRL
DTVFNEVRRVARNLRPALLDDLGLLAALEHLAREMQEGSGLRISVSHTGKPRELADEQAT
ALYRIAQEALTNVERHAHARHVTLVLAFDASATRLTVQDDGAGFDVARMQLDPKRGIGLR
NLRERIAALGGEFDIVSGPGSTRLSAVVPVVPAQSATRHNPDSPDSPD