Protein Info for RR42_RS20515 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): large component of pyruvate transporter (cstA-like)
Rationale: Specifically important for pyruvate utilization. 70% identical to E. coli cstA, which is involved in pyruvate transport (PMID:29358499)
Original annotation: carbon starvation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 690 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 465 to 484 (20 residues), see Phobius details amino acids 510 to 529 (20 residues), see Phobius details amino acids 542 to 566 (25 residues), see Phobius details amino acids 573 to 593 (21 residues), see Phobius details amino acids 639 to 660 (22 residues), see Phobius details PF02554: CstA" amino acids 33 to 591 (559 residues), 887.2 bits, see alignment E=2.6e-271

Best Hits

Swiss-Prot: 73% identical to CSTA_ECOLI: Peptide transporter CstA (cstA) from Escherichia coli (strain K12)

KEGG orthology group: K06200, carbon starvation protein (inferred from 95% identity to reu:Reut_A3417)

MetaCyc: 73% identical to pyruvate transporter CstA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-335

Predicted SEED Role

"Carbon starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7X7 at UniProt or InterPro

Protein Sequence (690 amino acids)

>RR42_RS20515 large component of pyruvate transporter (cstA-like) (Cupriavidus basilensis FW507-4G11)
MNRIGQHLVWLAVAILGAFAFATVALSRGEAVSALWIVVAAICIYLIAYRYYSKFIAEKV
MQLDPKRMTPAWRHNDGLDYVPTNKAVLFGHHFAAIAGAGPLVGPVLAAQMGYMPGMLWI
LAGVVFAGAVQDFMVLFISTRRDGRSLGDLIKSEMGTVPGMIALFGCFMIMIIILAVLAL
IVVKALAGSPWGTFTVGVTIPIALFMGIYTRYIRPGRIGEVSVIGFVLLMLAIIGGQYVH
ESAVLAPLFTYDGKALTWMLIIYGFIAAVLPVWLLLAPRDYLSTFLKIGTIIALAIGILI
VAPELKMPAFTQFAKGGGPVWSGNLFPFLFITIACGAVSGFHALISSGTTPKLLESEAHM
RFIGYGAMLAESFVAIMALVAASVIEPGVYFAMNSPAAVIGTSPESVAQVVSGWGFVITP
DVLIQTAKDVGENSIISRAGGAPTLAVGIAHILHQVVGGQAMMAFWYHFAILFEALFILT
AVDAGTRAGRFMLQDLLGSFVPSFRRTDSLPANLIATALTVSFWGYFLYQGVVDPLGGIN
TLWPLFGISNQMLAAVALVLGTCVLVKMKRGQYAWVTLVPTIWLLICTLTAGWQKLFDAD
PKVSFLTHAAKFSDAIAQGKVLAPAKSMEQMHRIVFNDYLDAGLCALFMFVVLSIVFYGF
KTAMKARAENRPTDRETPFEPMPASASAQH