Protein Info for RR42_RS20265 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 24 to 47 (24 residues), see Phobius details amino acids 49 to 83 (35 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 221 to 246 (26 residues), see Phobius details amino acids 257 to 283 (27 residues), see Phobius details amino acids 302 to 328 (27 residues), see Phobius details PF02653: BPD_transp_2" amino acids 47 to 293 (247 residues), 117.8 bits, see alignment E=2.5e-38

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 89% identity to reh:H16_A3658)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFD3 at UniProt or InterPro

Protein Sequence (342 amino acids)

>RR42_RS20265 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MNQPTGAAVAAGQTRQGRGVQKKLLYGLLLAALVLAPMAGAYPVFVLKVLCFALFACAFN
LLIGYTGLLSFGHAAFFGGAAYTAGHAMKAWGVTPEVGLVLGTLAGALIGYVVGYIAIRR
QGIYFSMITLALAQMLFFFCLQVPYTGGEDGLQGIPRGKLFGVLSLANDLTLYYVALAII
VAAFALIVRTVHSPFGQILKAIKENEPRTISLGYDTDRFKLMVFVLSAALSGLAGSIKAL
VLGFATLTDVHWSMSGSVILMTLVGGLGTLSGPLVGAFVVVALENKLGDIGTFLASTTGI
EWFNSLGESVTMVTGVIFVICVLTFRRGIMGELLARFGKARE