Protein Info for RR42_RS20210 in Cupriavidus basilensis FW507-4G11

Annotation: 16S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details PF02527: GidB" amino acids 33 to 221 (189 residues), 150.8 bits, see alignment E=1.4e-48 TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG" amino acids 39 to 233 (195 residues), 150 bits, see alignment E=2.8e-48

Best Hits

Swiss-Prot: 82% identical to RSMG_CUPMC: Ribosomal RNA small subunit methyltransferase G (rsmG) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 82% identity to rme:Rmet_3505)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YF24 at UniProt or InterPro

Protein Sequence (235 amino acids)

>RR42_RS20210 16S rRNA methyltransferase (Cupriavidus basilensis FW507-4G11)
MRNQRYAAVDDADQRRRLEAGLSAIGLAVCASQIDQLFAYLALLRKWNAIYNLTAIRHPD
EMLTHHMLDSLAAVPALAQAARAAEVEEGARGRVLDVGSGGGMPGLPLAITCPDLSVLMV
DIVQKKTAFLTQCRAQLGLSNAAAHWGPVEKLEDGKGYAVITSRAFAELSDFVSLAGHLL
APGGKLIAMKGVYPQPELDRMEAAGLMAEWQVEAIPRLTVPELDAERHLVVLSRR