Protein Info for RR42_RS20195 in Cupriavidus basilensis FW507-4G11

Annotation: ATPase F0F1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 transmembrane" amino acids 58 to 77 (20 residues), see Phobius details amino acids 83 to 107 (25 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details PF03899: ATP-synt_I" amino acids 57 to 153 (97 residues), 47.2 bits, see alignment E=1.3e-16

Best Hits

KEGG orthology group: K02116, ATP synthase protein I (inferred from 73% identity to rme:Rmet_3501)

Predicted SEED Role

"ATP synthase protein I" in subsystem F0F1-type ATP synthase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFB9 at UniProt or InterPro

Protein Sequence (166 amino acids)

>RR42_RS20195 ATPase F0F1 (Cupriavidus basilensis FW507-4G11)
MVSDRQDAGRKTDWQTRDAWEDEAEREEEAVDPLSRVEAETLFGERALRPSRMTPGRVVL
AQVAVTLLSAIAWRLFAGGNAGAAGWSALFGGTVCFVPSGFFALRLWMARERPSISGLVV
GEAIKVFATAGLFVLVVVLYSELRWVPMLVTFLLVLKTYWVALAIR