Protein Info for RR42_RS20180 in Cupriavidus basilensis FW507-4G11

Annotation: ATP synthase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00430: ATP-synt_B
  • amino acids 6 to 136 (131 residues), 100.1 bits, E=5.6e-33
• TIGR01144: ATP synthase F0, B subunit
  • amino acids 10 to 156 (147 residues), 136.8 bits, E=2.6e-44

Best Hits

Swiss-Prot: 99% identical to ATPF_CUPMC: ATP synthase subunit b (atpF) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K02109, F-type H+-transporting ATPase subunit b [EC: 3.6.3.14] (inferred from 97% identity to reu:Reut_A3350)

MetaCyc: 44% identical to ATP synthase Fo complex subunit b (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase F0 sector subunit b"

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

See A0A0C4Y7P5 at UniProt or InterPro

Protein Sequence (156 amino acids)

>RR42_RS20180 ATP synthase subunit B (Cupriavidus basilensis FW507-4G11)
MNLNATFFAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAAEKGKAELELANKR
VDQALAEARTEGAQRVADAEKRAQLTADEIKQNAQAEAARIIAQAKAEAEQQVTRAREQL
RDQVAVLAVKGAEQILKREVNAQVHADLLNQLKAEL