Protein Info for RR42_RS20065 in Cupriavidus basilensis FW507-4G11

Annotation: glycine cleavage system protein H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 TIGR00527: glycine cleavage system H protein" amino acids 3 to 123 (121 residues), 158.9 bits, see alignment E=3.1e-51 PF01597: GCV_H" amino acids 7 to 123 (117 residues), 145.8 bits, see alignment E=5.7e-47 PF00364: Biotin_lipoyl" amino acids 46 to 80 (35 residues), 24 bits, see alignment E=2.8e-09

Best Hits

Swiss-Prot: 74% identical to GCSH_RALSO: Glycine cleavage system H protein (gcvH) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 94% identity to cti:RALTA_A3075)

MetaCyc: 57% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7M5 at UniProt or InterPro

Protein Sequence (126 amino acids)

>RR42_RS20065 glycine cleavage system protein H (Cupriavidus basilensis FW507-4G11)
MNFPADLKYTESHEWVRVEADGTLTIGITDHAQDALGDIVFLELPEVGKSVGAGDALAVV
ESVKAASDIYAPVAGEVIAINDAAAAAPESVNADAFDAWLFKLKPANSDDVNGLMSADAY
KANVGA