Protein Info for RR42_RS19885 in Cupriavidus basilensis FW507-4G11

Annotation: aminoglycoside transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1032 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 336 to 358 (23 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details amino acids 439 to 462 (24 residues), see Phobius details amino acids 469 to 495 (27 residues), see Phobius details amino acids 536 to 554 (19 residues), see Phobius details amino acids 867 to 886 (20 residues), see Phobius details amino acids 893 to 913 (21 residues), see Phobius details amino acids 919 to 943 (25 residues), see Phobius details amino acids 967 to 986 (20 residues), see Phobius details amino acids 999 to 1022 (24 residues), see Phobius details PF00873: ACR_tran" amino acids 1 to 1022 (1022 residues), 1039 bits, see alignment E=0 TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 1 to 1027 (1027 residues), 1196.3 bits, see alignment E=0 PF03176: MMPL" amino acids 297 to 533 (237 residues), 45.2 bits, see alignment E=6.3e-16

Best Hits

KEGG orthology group: None (inferred from 79% identity to reh:H16_A3604)

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YL83 at UniProt or InterPro

Protein Sequence (1032 amino acids)

>RR42_RS19885 aminoglycoside transporter (Cupriavidus basilensis FW507-4G11)
MASFFLRRPAFAWVIAILTMVAGLIALTRIPIAQYPAVAPPTVIVYADYAGASARTVEDA
VTAVLEQQMHGIPGLLYLDASSEGGAATITLGFRQGTDAQLAQVNVRNRVMQAEPLLPEA
VRRGGIFVDQAGSSPFMYVSLVSQNSQLDETALGDFAAASVLPMLRRLPGIGKAEPYGAE
YALRIWFDPDKLNAYGLTAADVEQAIKARNGDVTPGQLGGAPAVPGQPYQALVRPPRPLA
EPEAFGQIVVRAGGDASLVRLRDVARVELGASDYRYSSRHDGQVAASIGLKLADGANVLA
TSRAVRAALDEAARGFPTGMRYEISSDSAQFVERSIWRVLTTLGEATALVFLILYLFLGN
LRATLIPVIVVPVSLLGTVACLYALGLSLNVITLFGVVLAIGILVDDAIVVVENVERIMR
EDGVHAMAAATRSMREVSGALVGVTLVLCAVFVPMAFLGSAVGVIYRHFAITLAISIAFS
LFFALSLAPAMCASLLRHAPHPQRGPLAWFERGFTALTARYAGWVLALQRRRPRWLGIYL
ALAVAGGVLMWQIPAGFLPEEDTGELVIDMELPAGATQAQTRATVAALEAWLKAGKYPVR
STFAVLGWSNSGNGEQRASMYLALRDWSERGAGERADAVLARLQAGLQAWPGRGQAQLYA
YNGAALPELGSTGGLDMRLVAQAGSGREALFAARDRLLAAVKDEPSLGEVRATTGEPAPA
LDLHIDYERARSFGVEPEAIHHALSATLGSRYIDEVAREGRIRRVILQADAPYRMDPAKL
SRVHVRNASGGMVSLGAFAELAWGKGEATLERFNGLTSVRINAEVAPGHSTGTAMERLTA
RVRELGGAYDVRWTGRAFEQQQSGTQAPWLFALSMLFIFLCLVALYENWTLPLAVLLIVP
AGLVGALVAIWLRGMPNDVYFKVGGVVIMGLAAKNAILVVEYAEQLRRGGMDLLEAAGQA
ARQRLRPVVMTSLAFVLGVVPLAISTGPGAAAQRAVGTGVLGGMLGATVIGSLAVPLLYV
LIGRRRAGRERE